PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR11G02970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 422aa    MW: 44265.5 Da    PI: 7.6197
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR11G02970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.34.4e-10118180163
                      XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                      eke kr rr   NRe+Ar   +R++a  +eL++kv+ L+++N+++kke +   +e+ +lk  +
  LPERR11G02970.1 118 EKEAKRLRRVLANRESARQTILRRQAIRDELARKVADLSSQNETMKKEKDVVMQEYLSLKETN 180
                      89*********************************************************9877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-12118182IPR004827Basic-leucine zipper domain
PfamPF001702.0E-8118180IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.979120183IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.09E-6122178No hitNo description
Gene3DG3DSA:1.20.5.1702.7E-5122187No hitNo description
CDDcd147022.46E-13123173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MSDHSSSDGQ QRQCRRRGVA ADVELDAAMA LADMAGAAPG QAEAPPPPQA AAAAAAKAEN  60
EDEEAELAST RLSLELGKVG IQSSSPCSSS SSAGHPAMHA AAAPGYGPRP RHMLTEAEKE  120
AKRLRRVLAN RESARQTILR RQAIRDELAR KVADLSSQNE TMKKEKDVVM QEYLSLKETN  180
KQLKEQAHHH HLSLSVAVTA TVRPKSKQNL VAIRTTKKAA AAVAAEPMDT SPPALAQQQA  240
EAAAVPTTAT PPSTSFLYTA APPAMPVPYM WGSWPPYEHG NLAAAASTAA PPLCLPPCAW  300
YYPVVAGDPR GASPPTSTYP QPFQEQQQQP TSSPGGGTAE EDTDDDPCSL TLAIDVDKRT  360
TSSSVAVAVA GAAGTGQQVS LSDREKAATA AEARKRRKEL TKLKQMHGGG GGARPGGGGE  420
QW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1393398RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2879051e-176AK287905.1 Oryza sativa Japonica Group cDNA, clone: J065211O07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615785.11e-143PREDICTED: translation initiation factor IF-2
TrEMBLA0A0D9XP690.0A0A0D9XP69_9ORYZ; Uncharacterized protein
STRINGLOC_Os11g05640.11e-143(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP31653475
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19490.19e-17bZIP family protein